PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim11g010270.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 351aa    MW: 39362.9 Da    PI: 4.3093
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim11g010270.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.31.3e-1857110356
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         k+++++ eq+++Le+ Fe ++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  Sopim11g010270.0.1  57 KKRRLSVEQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWK 110
                         456899***********************************************9 PP

2HD-ZIP_I/II130.56.8e-4256148193
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         +kkrrls eqvk+LE++Fe e+kLeperKv+la+eLglqprqvavWFqnrRAR+ktkqlE+dy++Lk+++d+lk++ e+L++++e+L++e+
  Sopim11g010270.0.1  56 QKKRRLSVEQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLERDYNVLKANFDSLKHNYESLKHDNEALAKEI 146
                         69**************************************************************************************999 PP

         HD-ZIP_I/II  92 ke 93 
                         +e
  Sopim11g010270.0.1 147 RE 148
                         86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.8852112IPR001356Homeobox domain
SuperFamilySSF466893.34E-1953114IPR009057Homeodomain-like
SMARTSM003894.6E-1855116IPR001356Homeobox domain
CDDcd000861.99E-1756113No hitNo description
PfamPF000468.2E-1657110IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.5E-2059119IPR009057Homeodomain-like
PRINTSPR000311.1E-58392IPR000047Helix-turn-helix motif
PROSITE patternPS00027087110IPR017970Homeobox, conserved site
PRINTSPR000311.1E-592108IPR000047Helix-turn-helix motif
PfamPF021832.5E-17112152IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MKRLGSSDSL GALMSMCPST TDDQNHGNSH VYSTRDFQSM LELGLDEEGC VEESGQKKRR  60
LSVEQVKALE KNFEVENKLE PERKVKLAQE LGLQPRQVAV WFQNRRARWK TKQLERDYNV  120
LKANFDSLKH NYESLKHDNE ALAKEIRELK FKVYGGENGE SRGAVVVSVK EEAMESDNDD  180
KMIEQNNPND LLEEDDEDQD DDVEINATIA STIFADFNKD GSSDSDNSSA ILNEDNSPNA  240
AAISSSGAFL ISNDGGVGCS SPNSLNFTFK FTESSPKSIL GDSQKANCFT YQPPSTTTTT  300
QYVKMEEHNF FNGEESCSTL FSDEQAPTLQ WYCSEDWNFK DSKSSFFDHE *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1104112RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00271DAPTransfer from AT2G22430Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755230.0HG975523.1 Solanum lycopersicum chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004250119.10.0PREDICTED: homeobox-leucine zipper protein ATHB-6
TrEMBLK4D5I80.0K4D5I8_SOLLC; Uncharacterized protein
STRINGSolyc11g010270.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27182453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22430.17e-63homeobox protein 6